Protein coding transcript 160556

• Transcript: Ll_transcript_241505
• CDS coordinates: 244-543 (+)
• Peptide sequence: MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSEVCYHFLYSFFLCVIDTHIFIYLSFFINSTDSFRILPEFVFGLHLLLKIDRNLAVVSFPVNR*
• ORF Type: complete

Annotations of Ll_transcript_241505

• Blastp: Cyclin-dependent kinases regulatory subunit 1 from Oryza sativa with 100% of identity
• Blastx: Cyclin-dependent kinases regulatory subunit 1 from Oryza sativa with 100% of identity
• Eggnog: (Regulatory) subunit(ENOG4111UAN)
• Kegg: Link to kegg annotations (4331610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003606312.1)
• Pfam: Cyclin-dependent kinase regulatory subunit (PF01111.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;