Protein coding transcript 160745

• Transcript: Ll_transcript_222552
• CDS coordinates: 284-640 (+)
• Peptide sequence: MGSKNVDLFDAYFRRADLDRDGRISGHEAVSFFQASGLPKQVLAQIWGFANQSQSGFLGRAEFYNALKLVTVAQSKRELTPDIVKAALYGPAASKIPAPQINFTATAPAPAPAPAPAPA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_222552

• Blastp: EH domain-containing protein 2 from Arabidopsis with 43.21% of identity
• Blastx: EH domain-containing protein 2 from Arabidopsis with 43.21% of identity
• Eggnog: EH-domain containing(ENOG410XYGB)
• Kegg: Link to kegg annotations (AT4G05520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435797.1)
• Pfam: EF hand (PF13202.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;