Transcript | Ll_transcript_222552 |
---|---|
CDS coordinates | 284-640 (+) |
Peptide sequence | MGSKNVDLFDAYFRRADLDRDGRISGHEAVSFFQASGLPKQVLAQIWGFANQSQSGFLGRAEFYNALKLVTVAQSKRELTPDIVKAALYGPAASKIPAPQINFTATAPAPAPAPAPAPA |
ORF Type | 3prime_partial |
Blastp | EH domain-containing protein 2 from Arabidopsis with 43.21% of identity |
---|---|
Blastx | EH domain-containing protein 2 from Arabidopsis with 43.21% of identity |
Eggnog | EH-domain containing(ENOG410XYGB) |
Kegg | Link to kegg annotations (AT4G05520) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435797.1) |
Pfam | EF hand (PF13202.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer