Transcript | Ll_transcript_224044 |
---|---|
CDS coordinates | 49-351 (+) |
Peptide sequence | MDTGKSKKGASGRKGGGPRKKAVSRSFRAGLQFPVGRIGRYLKKGRYAQRVGTGAPIYLAAVLEYLAAEVIIAIIVEYFLEIFSWKKFLMFVKVIIYSIL* |
ORF Type | complete |
Blastp | Histone H2A from Euphorbia sect. Esula with 83.33% of identity |
---|---|
Blastx | Histone H2A from Petroselinum with 93.1% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433589.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer