Protein coding transcript 160848

• Transcript: Ll_transcript_224044
• CDS coordinates: 49-351 (+)
• Peptide sequence: MDTGKSKKGASGRKGGGPRKKAVSRSFRAGLQFPVGRIGRYLKKGRYAQRVGTGAPIYLAAVLEYLAAEVIIAIIVEYFLEIFSWKKFLMFVKVIIYSIL*
• ORF Type: complete

Annotations of Ll_transcript_224044

• Blastp: Histone H2A from Euphorbia sect. Esula with 83.33% of identity
• Blastx: Histone H2A from Petroselinum with 93.1% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433589.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;