Protein coding transcript 160849

• Transcript: Ll_transcript_224051
• CDS coordinates: 49-585 (+)
• Peptide sequence: MDTGKSKKGASGRKGGGPRKKAVSRSFRAGLQFPVGRIGRYLKKGRYAQRVGTGAPIYLAAVLEYLAAEVLELAGNAARDNKKTRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVIPNINPVLLPKRTGAGASSSAASTSKEPKSPSRAAKSPAKAAKSPSKAAKSPRKAAKSPRKAA*
• ORF Type: complete

Annotations of Ll_transcript_224051

• Blastp: Histone H2A from Petroselinum with 78.21% of identity
• Blastx: Probable histone H2A.2 from Medicago with 94.29% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433590.1)
• Pfam: Core histone H2A/H2B/H3/H4 (PF00125.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;