Protein coding transcript 160854

• Transcript: Ll_transcript_224057
• CDS coordinates: 62-463 (+)
• Peptide sequence: MAGRGKTLGSGTAKKATSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGDVTIANGGVMPNIHNLLLPKKAGSSKGAVADDE*
• ORF Type: complete

Annotations of Ll_transcript_224057

• Blastp: Probable histone H2A.1 from Arabidopsis with 93.18% of identity
• Blastx: Probable histone H2A.1 from Arabidopsis with 93.18% of identity
• Eggnog: histone h2a(COG5262)
• Kegg: Link to kegg annotations (AT1G51060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443099.1)
• Pfam: Core histone H2A/H2B/H3/H4 (PF00125.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;