Transcript | Ll_transcript_222393 |
---|---|
CDS coordinates | 236-1012 (+) |
Peptide sequence | MLFLNTYFLSRLFFGAGTTVFPKKSQTKLILLGASRAMPSSSYPVIPTSSVKAASTNSNIGSAGHMLSNRAKCGDDIPFSPVSEIHSPAFISYPHGNGDISWDQYPFQDFIKFPDSVPIQNNQVEHSASYISGENAQTTDLGEWADVDQLLSADDSLFPIWGQFLGDSHVAEPKLEVTQVSQQQHAQSKEVKCLPNSVSTAPQTKSRMRWTPELHEAFVEAVNQLGGSEKATPKGVLKLMKVEGLTIYHVKSHLQVRL* |
ORF Type | complete |
Blastp | Protein PHR1-LIKE 1 from Arabidopsis with 49.08% of identity |
---|---|
Blastx | Protein PHR1-LIKE 1 from Arabidopsis with 49.08% of identity |
Eggnog | MYB family transcription factor(ENOG41113XD) |
Kegg | Link to kegg annotations (AT5G29000) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439919.1) |
Pfam | Myb-like DNA-binding domain (PF00249.30) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer