Protein coding transcript 160915

• Transcript: Ll_transcript_223397
• CDS coordinates: 270-1079 (+)
• Peptide sequence: MSQSLIAVPLTQQLFKRNNGVLSFFASSHSTSSIFRSHSLSLFSQNQKRRNPLSPIKPPSVSFSSSQTTMGGDTPQNDAGMDAVQRRLMFDDECILVDETDRVVGHDSKYNCHLMEKIDSENLLHRAFSVFLFNSKYELLLQQRSATKVTFPLVWTNTCCSHPLYRESELIDENSLGVRNAAQRKLLDELGIPAEDVPVDQFTPLGRILYKAPSDGKWGEHELDYLLFTVRDVNLHPNPDEVADVKYVTRDQLKELLRKADAGEEGLKLS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_223397

• Blastp: Isopentenyl-diphosphate Delta-isomerase II from Camptotheca with 86.47% of identity
• Blastx: Isopentenyl-diphosphate Delta-isomerase II from Camptotheca with 86.47% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431222.1)
• Pfam: NUDIX domain (PF00293.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;