Transcript | Ll_transcript_222279 |
---|---|
CDS coordinates | 2-364 (+) |
Peptide sequence | WPLLGILPGLIENCDRMHDWICDNLRACGGTYQTCICAIPFLAKKQGLVTVTCDPRNLEHILKTRFDNYPKGPMWHAVFHDLLGDGIFNSDGDTWLFQRKTAALEFTTRTLRQAMARWVSR |
ORF Type | internal |
Blastp | Cytochrome P450 86A8 from Arabidopsis with 91.74% of identity |
---|---|
Blastx | Cytochrome P450 86A8 from Arabidopsis with 91.74% of identity |
Eggnog | Cytochrome p450(COG2124) |
Kegg | Link to kegg annotations (AT2G45970) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432999.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer