Protein coding transcript 160969

• Transcript: Ll_transcript_222279
• CDS coordinates: 2-364 (+)
• Peptide sequence: WPLLGILPGLIENCDRMHDWICDNLRACGGTYQTCICAIPFLAKKQGLVTVTCDPRNLEHILKTRFDNYPKGPMWHAVFHDLLGDGIFNSDGDTWLFQRKTAALEFTTRTLRQAMARWVSR
• ORF Type: internal

Annotations of Ll_transcript_222279

• Blastp: Cytochrome P450 86A8 from Arabidopsis with 91.74% of identity
• Blastx: Cytochrome P450 86A8 from Arabidopsis with 91.74% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: Link to kegg annotations (AT2G45970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432999.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;