Protein coding transcript 161135

• Transcript: Ll_transcript_222188
• CDS coordinates: 1-909 (+)
• Peptide sequence: PVNKKNTYKSEAATWSFSLAEKFLIVTIQYLHTNINALFVSTMFFRGKYGDGGDGREMAPKRQRTIDQGSSFYGSPGSSFMYNSPPYGYVSQPPPPPPFPVVRLRGLPFDCTEIDVAEFFHGLDIVDVLFVHKGGKFSGEAFCVLGYPLQVDYALQRNRHNIGRRYVEVFRSKRQEYYKAIANEVSEARGGSPRHSASRAKSYDEGKDSAEHTGVLRLRGLPFSATKDDIMDFFNDFVLSEDSIHIIMNLEGRPSGEAYVEFENAEESKAAMTKDRMTLGSRYIELFPSSHSEMEDAISRGR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_222188

• Blastp: Heterogeneous nuclear ribonucleoprotein F from Macaca with 37.19% of identity
• Blastx: Heterogeneous nuclear ribonucleoprotein F from Macaca with 35.08% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (101867097)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449884.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;