Protein coding transcript 161228

• Transcript: Ll_transcript_222926
• CDS coordinates: 174-1124 (+)
• Peptide sequence: MSDRFFPNEMPPFVSETDETLQTSTTTSLTTLLSLPYQTLSSKFQASAFHFKQLVVRETWGSSGKRVKDYTLYTGALGTAYLVFKAYQVTQDSGDLKLCSEIVKACDSASANSSRVTFICGHAGVCALGAVIAKHIGDERLLNYYLRRFKEINVPHDSPYELLYGRAGYLWACSFLNKYISKDTIPSTHMRSVVEEVIAAGRQLAHKGRCPLKYEWHGKKYWGAAHGLAGIMHVLMDMELKPDEVEDVKGTLCYMIKNRFPSGNYPSSEGNESDRLVHWCHGAPGVTLTLVKAAEVIFTLVIKFKCKLHAKSIRCK*
• ORF Type: complete

Annotations of Ll_transcript_222926

• Blastp: LanC-like protein GCR2 from Arabidopsis with 67.55% of identity
• Blastx: LanC-like protein GCR2 from Arabidopsis with 64.9% of identity
• Eggnog: glutathione binding(ENOG410XQIA)
• Kegg: Link to kegg annotations (AT1G52920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004487685.1)
• Pfam: Lanthionine synthetase C-like protein (PF05147.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;