Protein coding transcript 161257

• Transcript: Ll_transcript_223423
• CDS coordinates: 54-452 (+)
• Peptide sequence: MTFKRRNGGRNKHGRGHVKFIRCSNCGKCCPKDKSIKRFVVRNIVEQAAVRDVQEASVFEQYTLPKLYVKLHYCVSCAIHSHVVRVRSRTDRRKRDPPQRFIRRRDDAPRPGQPGQPGQAPRPAGVVAPPRA*
• ORF Type: complete

Annotations of Ll_transcript_223423

• Blastp: 40S ribosomal protein S26-1 from Arabidopsis with 82.76% of identity
• Blastx: 40S ribosomal protein S26-3 from Arabidopsis with 84.11% of identity
• Eggnog: Ribosomal protein(COG4830)
• Kegg: Link to kegg annotations (AT2G40590)
• CantataDB: Link to cantataDB annotations (CNT0000153)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414365.1)
• Pfam: Ribosomal protein S26e (PF01283.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;