Protein coding transcript 161299

• Transcript: Ll_transcript_223992
• CDS coordinates: 1185-1643 (+)
• Peptide sequence: MLYAGGVPHLAMVEGVDNQKVANHLERVVSTLGRNPLKILVQVNTSGEASKSGIDPSNCVELAKHVKSCCPNLVFSGLMTIGRPDYTSTPENFQCLSKCRTDVCEALEMDEEQCELSMGMSSDFELAIEMGSTNVRIGSTIFGPREYAKKQE*
• ORF Type: complete

Annotations of Ll_transcript_223992

• Blastp: Pyridoxal phosphate homeostasis protein from Mus with 51.68% of identity
• Blastx: Pyridoxal phosphate homeostasis protein from Mus with 51.68% of identity
• Eggnog: alanine racemase domain protein(COG0325)
• Kegg: Link to kegg annotations (114863)
• CantataDB: Link to cantataDB annotations (CNT0000624)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440694.1)
• Pfam: Alanine racemase, N-terminal domain (PF01168.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;