Protein coding transcript 161323

• Transcript: Ll_transcript_224225
• CDS coordinates: 898-1263 (+)
• Peptide sequence: MQAFKIVVTDPDTVLSTLTREVKEVGSDGEEVTKVVPAVSEEVKDALVKNIRRRMTPQPLKIRADIEMKCFQFDGVVHIKEAMRKAEAAGNDDCPVKIKLVAPPLYVLTTQTLDKVIAIFT*
• ORF Type: complete

Annotations of Ll_transcript_224225

• Blastp: Eukaryotic translation initiation factor 2 subunit alpha homolog from Arabidopsis with 87.72% of identity
• Blastx: Eukaryotic translation initiation factor 2 subunit alpha homolog from Arabidopsis with 91.28% of identity
• Eggnog: translation initiation factor(COG1093)
• Kegg: Link to kegg annotations (AT2G40290)
• CantataDB: -
• Mirbase: cme-MIR854 (MI0023204)
• Ncbi protein: Link to NCBI protein (XP_019416821.1)
• Pfam: Eukaryotic translation initiation factor 2 alpha subunit (PF07541.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;