Transcript | Ll_transcript_224234 |
---|---|
CDS coordinates | 785-1111 (+) |
Peptide sequence | MNSASVSNSETDIPLSSLASIDKVTTLSEDVGFGKRRSHRCLVVTARSRAFLYHQVRLLVGVLKAVGTGNLTISDVERILNAKDVTAASPMAPACGLYLGEVKYDLSS* |
ORF Type | complete |
Blastp | tRNA pseudouridine synthase A from Leuconostoc with 36.89% of identity |
---|---|
Blastx | tRNA pseudouridine synthase A from Bartonella with 39.87% of identity |
Eggnog | Formation of pseudouridine at positions 38, 39 and 40 in the anticodon stem and loop of transfer RNAs (By similarity)(COG0101) |
Kegg | Link to kegg annotations (LEUM_0228) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424639.1) |
Pfam | tRNA pseudouridine synthase (PF01416.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer