| Transcript | Ll_transcript_224238 |
|---|---|
| CDS coordinates | 179-481 (+) |
| Peptide sequence | MIQDSKDRVEEEEESGCDENRPSKISKTSHNNTNSEAMNGKVQRYLVAIEYIGTHFSGSQQQPIHRTVIGVLQDAFSKFIGQPISITSSSRTLRCGPNAV* |
| ORF Type | complete |
| Blastp | tRNA pseudouridine synthase A from Lactobacillus with 51.02% of identity |
|---|---|
| Blastx | tRNA pseudouridine synthase A from Magnetospirillum with 44.06% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (LSEI_2471) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019424639.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer