| Transcript | Ll_transcript_223506 |
|---|---|
| CDS coordinates | 471-779 (+) |
| Peptide sequence | MLAFFLLLFDRISDCGLMMQSIEELAVRYPATKFVKIISTDCIPNYPDRNLPTLLVYNNGAVKGNYVGLHSFGRRCTPEGSYVTVCWILCFASLSFNFTTSY* |
| ORF Type | complete |
| Blastp | Phosducin-like protein 3 from Danio with 52.54% of identity |
|---|---|
| Blastx | Viral IAP-associated factor homolog from Sophophora with 45.45% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (403034) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019442846.1) |
| Pfam | Phosducin (PF02114.15) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer