Protein coding transcript 161375

• Transcript: Ll_transcript_223519
• CDS coordinates: 471-869 (+)
• Peptide sequence: MLAFFLLLFDRISDCGLMMQSIEELAVRYPATKFVKIISTDCIPNYPDRNLPTLLVYNNGAVKGNYVGLHSFGRRCTPEGVAFVLCQSDPVLNDGHSTNEKSREAVIAGVQKRFIEKIVADHEEDDGGSSSD*
• ORF Type: complete

Annotations of Ll_transcript_223519

• Blastp: Viral IAP-associated factor homolog from Sophophora with 43.59% of identity
• Blastx: Viral IAP-associated factor homolog from Sophophora with 44% of identity
• Eggnog: Phosducinlike(ENOG4111H24)
• Kegg: Link to kegg annotations (Dmel_CG18593)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442846.1)
• Pfam: Phosducin (PF02114.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;