Protein coding transcript 161391

• Transcript: Ll_transcript_222831
• CDS coordinates: 2234-2797 (+)
• Peptide sequence: MLNRNVYLVDVVREDIGRVLKLDSIEGSKLWRGIDMLIFNTWHWWSRRGPTQPWDYIQEGSEVMKDMDRMEAFEKALKTWGAWVDANIDPEKVKVFFQGISPSHYNGSLWNEPSAKSCVREITPVAGSTYPGGLPPPVTVLKSVLRTIKKPVTLLDITTLSLLRKDGHPSIYGLGGPTGMDCSHWCLP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_222831

• Blastp: Protein trichome birefringence-like 41 from Arabidopsis with 68.98% of identity
• Blastx: Protein trichome birefringence-like 41 from Arabidopsis with 67.18% of identity
• Eggnog: Pfam:DUF231(ENOG41118PY)
• Kegg: Link to kegg annotations (AT3G14850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443850.1)
• Pfam: GDSL/SGNH-like Acyl-Esterase family found in Pmr5 and Cas1p (PF13839.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;