Protein coding transcript 161396

• Transcript: Ll_transcript_222835
• CDS coordinates: 848-1198 (+)
• Peptide sequence: MSQICSPSEWNTGVTTVTTKNCYGETEPITSSGYTGPYPDQMRVVDTVIREMNNHVYLLDITMLSAFRKDAHPSIYDGDLSPEQRAKPDYSADCSHWCLPGLPDTWNQLFYTALFY*
• ORF Type: complete

Annotations of Ll_transcript_222835

• Blastp: Protein trichome birefringence-like 45 from Arabidopsis with 56.9% of identity
• Blastx: Protein trichome birefringence-like 45 from Arabidopsis with 56.9% of identity
• Eggnog: Pfam:DUF231(ENOG410YF78)
• Kegg: Link to kegg annotations (AT2G30010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420088.1)
• Pfam: GDSL/SGNH-like Acyl-Esterase family found in Pmr5 and Cas1p (PF13839.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;