Protein coding transcript 161397

• Transcript: Ll_transcript_222837
• CDS coordinates: 123-938 (+)
• Peptide sequence: MRGKSVMFVGDSLGRNQWQSLICMISAAAPQTQTQLVRGEPLSTFRFLDYGVTISFYRAPYLVEIDVVQGKRILRLEELDGNGAAWRSADVLSFNTGHWWSHQGSLQGWDYIELGGKYYPDMDRLAALERGMKTWANWVDTNIDKSTTKVFFLGISPSHNNPSEWNTGVTTVTTKNCYGETEPITSSGYTGPYPDQMRVVDTVIREMNNHVYLLDITMLSAFRKDAHPSIYDGDLSPEQRAKPDYSADCSHWCLPGLPDTWNQLFYTALFY*
• ORF Type: complete

Annotations of Ll_transcript_222837

• Blastp: Protein PMR5 from Arabidopsis with 61.54% of identity
• Blastx: Protein PMR5 from Arabidopsis with 61.7% of identity
• Eggnog: Pfam:DUF231(ENOG410YF78)
• Kegg: Link to kegg annotations (AT5G58600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420088.1)
• Pfam: GDSL/SGNH-like Acyl-Esterase family found in Pmr5 and Cas1p (PF13839.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;