Protein coding transcript 161398

• Transcript: Ll_transcript_222840
• CDS coordinates: 77-940 (+)
• Peptide sequence: MAPIPLHLQPLSSSAVLPLSLAFLFLVSLQCHVASSALILSLRHQHNQLHHQRPMIHSNQTNCELFMGTWVRDDTYPLYQSSSCPIIDPEFNCQMYGRPDSNYLKYRWRPLNCELPRFNGVEFLLGMRGKSVMFVGDSLGRNQWQSLICMISAAAPQTQTQLVRGEPLSTFRFLDYGVTISFYRAPYLVEIDVVQGKRILRLEELDGNGAAWRSADVLSFNTGHWWSHQGSLQGWDYIELGGKYYPDMDRLAALERGMKTWANWVDTNIDKSTTKVFFLGISPSHNK*
• ORF Type: complete

Annotations of Ll_transcript_222840

• Blastp: Protein PMR5 from Arabidopsis with 58.12% of identity
• Blastx: Protein PMR5 from Arabidopsis with 62.66% of identity
• Eggnog: Pfam:DUF231(ENOG410YF78)
• Kegg: Link to kegg annotations (AT5G58600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420088.1)
• Pfam: PMR5 N terminal Domain (PF14416.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;