Protein coding transcript 161404

• Transcript: Ll_transcript_223496
• CDS coordinates: 2-349 (+)
• Peptide sequence: SFHSLFCSLLIRSISISFPTPQTLHQIQNHTSSTINQSTMAPAVQRRSGGGVFEGLYKVLMRRNSVYVTFVIVGAFAGERAVDYGVHKIWERNNVGVLFLHVSYFCFVFHYLFFN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_223496

• Blastp: Cytochrome b-c1 complex subunit 9 from Solanum with 65.52% of identity
• Blastx: Cytochrome b-c1 complex subunit 9 from Solanum with 62.3% of identity
• Eggnog: mitochondrial electron transport, ubiquinol to cytochrome c(ENOG410XUZE)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004494176.1)
• Pfam: Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like (PF05365.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;