Protein coding transcript 161405

• Transcript: Ll_transcript_223502
• CDS coordinates: 14-970 (+)
• Peptide sequence: MGKSIHKATSSAGDNPPGKRIRRSKAICSCNSPRPPFLSAHSTFSWYEEDMWTEIAKFLDGKSLVMLAATNRWFRRAIMEDTIWKFVCLRDLQVPPSPCVAFKWSKLYTSAFDGSHSYMFRQQEKHIDWMRIGAFSFDSSEAILAERLAFPGKIRTKEAMEKMLKSQGCCMLENVKPGIWIADLQLVRCPVCDLNMCDGTMQTLDARHIELFLCEDYQNGSWEYELVGSHDVKKRADGAAGAIFDPKHLEDSSTAAVFDYKSWIGKSNDWQPKAMIAFHAVAVNTNLQENEGLHVKYHAMRAGTDGQVVSIRISQQLL*
• ORF Type: complete

Annotations of Ll_transcript_223502

• Blastp: Probable F-box protein At3g61730 from Arabidopsis with 61.89% of identity
• Blastx: Probable F-box protein At3g61730 from Arabidopsis with 61.89% of identity
• Eggnog: F-box protein(ENOG4111KNI)
• Kegg: Link to kegg annotations (AT3G61730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460382.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;