Protein coding transcript 161585

• Transcript: Ll_transcript_222883
• CDS coordinates: 1084-1716 (+)
• Peptide sequence: MSPPPSDAMDTGNTSIVMASSTTSVPSSFSKFFSSISAQERTSLSLSTSPLFDSTSLFHDPHYTTPTVASPQPALSATALLQKAAQMGATSSNASLFHALGLETTSSNSGQDHITTLPWNTLIHIKQEEINQTLPHNLGLGLASGNSNAGFANAMMQSSSDLFGGPGQPTMTRDLLGLSIGNNGASLTSFFTSFGGNFQTSGGEGGGVGQ*
• ORF Type: complete

Annotations of Ll_transcript_222883

• Blastp: Protein indeterminate-domain 1 from Arabidopsis with 37.35% of identity
• Blastx: Protein indeterminate-domain 2 from Arabidopsis with 87.41% of identity
• Eggnog: Zinc finger protein(COG5048)
• Kegg: Link to kegg annotations (AT5G66730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417281.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;