Transcript | Ll_transcript_222431 |
---|---|
CDS coordinates | 413-721 (+) |
Peptide sequence | MLATASTPKRVKHQGSRRWHFASYNANLSFYWSSFLVQGIQRSDSPEKGSKYNTMYLDHVNERWARDIDEMDLIVLSFGHWLDYLLHYLFDVSLFCCKMILI* |
ORF Type | complete |
Blastp | Protein ALTERED XYLOGLUCAN 4 from Arabidopsis with 36.63% of identity |
---|---|
Blastx | Protein ALTERED XYLOGLUCAN 4 from Arabidopsis with 47.15% of identity |
Eggnog | Pfam:DUF231(ENOG410YAVP) |
Kegg | Link to kegg annotations (AT1G70230) |
CantataDB | Link to cantataDB annotations (CNT0002776) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447708.1) |
Pfam | GDSL/SGNH-like Acyl-Esterase family found in Pmr5 and Cas1p (PF13839.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer