Protein coding transcript 161615

• Transcript: Ll_transcript_222431
• CDS coordinates: 413-721 (+)
• Peptide sequence: MLATASTPKRVKHQGSRRWHFASYNANLSFYWSSFLVQGIQRSDSPEKGSKYNTMYLDHVNERWARDIDEMDLIVLSFGHWLDYLLHYLFDVSLFCCKMILI*
• ORF Type: complete

Annotations of Ll_transcript_222431

• Blastp: Protein ALTERED XYLOGLUCAN 4 from Arabidopsis with 36.63% of identity
• Blastx: Protein ALTERED XYLOGLUCAN 4 from Arabidopsis with 47.15% of identity
• Eggnog: Pfam:DUF231(ENOG410YAVP)
• Kegg: Link to kegg annotations (AT1G70230)
• CantataDB: Link to cantataDB annotations (CNT0002776)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447708.1)
• Pfam: GDSL/SGNH-like Acyl-Esterase family found in Pmr5 and Cas1p (PF13839.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;