Protein coding transcript 1617

• Transcript: Ll_transcript_317684
• CDS coordinates: 2-322 (+)
• Peptide sequence: TNPKGYRRGTRDLFSRKFRRRGVIPLSTYLKVYKVGDIVDVKGNGAVQKGLPHKSYHGKTGRVFNVSPHGLGVIVNKRVRGRIIPKRINIRIEHVKHSKCREDFLK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_317684

• Blastp: 60S ribosomal protein L21 from Mus with 67.92% of identity
• Blastx: 60S ribosomal protein L21 from Homo with 62.96% of identity
• Eggnog: (ribosomal) protein(COG2139)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016169403.1)
• Pfam: Ribosomal protein L21e (PF01157.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;