Protein coding transcript 161769

• Transcript: Ll_transcript_223748
• CDS coordinates: 864-1199 (+)
• Peptide sequence: MKFVWLVGQVAVQPMRRKGKGGLGVRCDFIGSPTNLIIVASTSLMLFAGRFGLAPSANRKATAGLKLEVRDSGLQTGDPAGFTLADTLACGTVGHIIGVGVVLGLKNIGAI*
• ORF Type: complete

Annotations of Ll_transcript_223748

• Blastp: Photosystem I reaction center subunit psaK, chloroplastic from Arabidopsis with 87.5% of identity
• Blastx: Photosystem I reaction center subunit psaK, chloroplastic from Arabidopsis with 87.5% of identity
• Eggnog: Photosystem I reaction center subunit(ENOG4111RY5)
• Kegg: Link to kegg annotations (AT1G30380)
• CantataDB: Link to cantataDB annotations (CNT0002231)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417871.1)
• Pfam: Photosystem I psaG / psaK (PF01241.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;