Protein coding transcript 161770

• Transcript: Ll_transcript_223750
• CDS coordinates: 2-400 (+)
• Peptide sequence: SQQMATSFTTTLPHFTGLRPKFSPAPVQNLVAVQPMRRKGKGGLGVRCDFIGSPTNLIIVASTSLMLFAGRFGLAPSANRKATAGLKLEVRDSGLQTGDPAGFTLADTLACGTVGHIIGVGVVLGLKNIGAI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_223750

• Blastp: Photosystem I reaction center subunit psaK, chloroplastic from Medicago with 84.25% of identity
• Blastx: Photosystem I reaction center subunit psaK, chloroplastic from Medicago with 84.68% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002231)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417872.1)
• Pfam: Photosystem I psaG / psaK (PF01241.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;