Transcript | Ll_transcript_223750 |
---|---|
CDS coordinates | 2-400 (+) |
Peptide sequence | SQQMATSFTTTLPHFTGLRPKFSPAPVQNLVAVQPMRRKGKGGLGVRCDFIGSPTNLIIVASTSLMLFAGRFGLAPSANRKATAGLKLEVRDSGLQTGDPAGFTLADTLACGTVGHIIGVGVVLGLKNIGAI* |
ORF Type | 5prime_partial |
Blastp | Photosystem I reaction center subunit psaK, chloroplastic from Medicago with 84.25% of identity |
---|---|
Blastx | Photosystem I reaction center subunit psaK, chloroplastic from Medicago with 84.68% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0002231) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417872.1) |
Pfam | Photosystem I psaG / psaK (PF01241.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer