Transcript | Ll_transcript_223826 |
---|---|
CDS coordinates | 2-955 (+) |
Peptide sequence | VGKLNRLVIPKQHAEKYFPLDSSSNEKGLLLNFEDRNGKLWKFRYSYWNSSQSYVMTKGWSRFVKEKKLDSGDIVSFKRGVGDLYRHVLYIDWKRRLDHSHNHNLLHDPSSTPLFLPNQYSITWGGRLHSLPSPNASTSTMLPPHHNLNYNSPLYHTFHHHQQQQQQLQYQQQYYDGRSGSGSGLGYLRSTPSMSMHQIGDQNLQERGNNIVPMIIDSVPVIHHHQQQDPHHGGIGTTTSNAGKMLRLFGVNMECASSSAEDSKCLPFSASAPLHVAMANSLSSTSLRAPYEDHSLSQSTRGTSVLFDLDPSLQYRH* |
ORF Type | 5prime_partial |
Blastp | B3 domain-containing transcription factor NGA3 from Arabidopsis with 46.69% of identity |
---|---|
Blastx | B3 domain-containing transcription factor NGA3 from Arabidopsis with 45.82% of identity |
Eggnog | Transcription factor(ENOG4111BY3) |
Kegg | Link to kegg annotations (AT1G01030) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440470.1) |
Pfam | B3 DNA binding domain (PF02362.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer