Protein coding transcript 161887

• Transcript: Ll_transcript_222786
• CDS coordinates: 1585-2538 (+)
• Peptide sequence: MGSCGREGAVRQYIRSKVPRLRWTHELHRCFVHAIERLGGHHKATPKLVLQLMDVKGLTISHVKSHLQMYRGMRGDLGRQGRTSTQHRNQSFEDYDCCVDEVNDVVVHYPACSKPIANESDSLFSSYSNLSPKRARIETRSCCISKSLQCSQRICDAVPNTYQSFYDMVEKKTEPKGIKESGYCFVGGSTWLTQQQQPHSHTLLQDFGNPSSSECPNQESDLLQVTKLNESKSTSQPMKIFMNTEKAHGKEDVRRCELSLSLSLANPSPQGSNDSSASEISEAISSWSGFTNYKDCYNFSTVKDRINLDLSLALCGN*
• ORF Type: complete

Annotations of Ll_transcript_222786

• Blastp: Putative Myb family transcription factor At1g14600 from Arabidopsis with 73.42% of identity
• Blastx: Putative Myb family transcription factor At1g14600 from Arabidopsis with 73.42% of identity
• Eggnog: Transcription factor(ENOG410YDJI)
• Kegg: Link to kegg annotations (AT1G14600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441738.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;