Transcript | Ll_transcript_223226 |
---|---|
CDS coordinates | 62-574 (+) |
Peptide sequence | MHLITDKPWWNFEDKKNPFNSGVLYIKRKVGACSYVDDPIGCQSLLSRAMHKVFGLTSSEASDTTTNIHSGPGSVTVDQLVGTFSSDPSLIAFAQLCCDPSWHNRSDVDFKDFCLQVLFECVSKDRPALLQVYLSLYTTVEAMVNQVGTGAIVFGDSLSISGFKLGLIYIE |
ORF Type | 3prime_partial |
Blastp | Anaphase-promoting complex subunit 1 from Homo with 29.51% of identity |
---|---|
Blastx | Anaphase-promoting complex subunit 1 from Homo with 29.51% of identity |
Eggnog | Anaphase promoting complex subunit 1(ENOG410XQ83) |
Kegg | Link to kegg annotations (64682) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433711.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer