Protein coding transcript 162002

• Transcript: Ll_transcript_222468
• CDS coordinates: 1377-1844 (+)
• Peptide sequence: MGLELSLARLKALAKYAFVLGLAQVVLSTLAFTAFELPPNGAIGTKVLEFLFHSRPDLVNIRSVDEAVVIGAALSLSSSAFVLQLLAEKGELPTRFGSATLGILLLQDLAVIPLLVILPILESQVRCNYKQYCVSLLIFKLTCCLFCCFFMNWWS*
• ORF Type: complete

Annotations of Ll_transcript_222468

• Blastp: K(+) efflux antiporter 3, chloroplastic from Arabidopsis with 90.32% of identity
• Blastx: K(+) efflux antiporter 3, chloroplastic from Arabidopsis with 84.46% of identity
• Eggnog: Sodium hydrogen exchanger(COG0475)
• Kegg: Link to kegg annotations (AT4G04850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421720.1)
• Pfam: Sodium/hydrogen exchanger family (PF00999.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;