Protein coding transcript 162015

• Transcript: Ll_transcript_222573
• CDS coordinates: 2-631 (+)
• Peptide sequence: GGGSYDPTPSPPSCSGNGGSYNPTPSPPSGLGGGSYNTTPSPSSNPPSGGGGNFNSPPTYGGDSPPTPIIVSPPSTPINLGTPSIPPFLPSPSPFTGTCNYWSNHPGIIWKLLGWWGTLGNAFSVPSMPGFGSSLTLPQALSNTRTDGLGALYREGTASFLNSLVNQKFPYTTQQVRDRFEASLSSNKAAAAQARLFRMANEGKMKLHL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_222573

• Blastp: Protodermal factor 1 from Arabidopsis with 54.55% of identity
• Blastx: Protodermal factor 1 from Arabidopsis with 66.96% of identity
• Eggnog: NA(ENOG410Z5QI)
• Kegg: Link to kegg annotations (AT2G42840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459861.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;