Transcript | Ll_transcript_164452 |
---|---|
CDS coordinates | 3-305 (+) |
Peptide sequence | CLYCQALLDHVCRNFYGPGSPYARFTGKECSRALALLSFKPEDINGNLEDLDESDLAVLEDWEYKFMEKYPKVGQLVPEKRIQQNEQKEQIQHNFNHDED* |
ORF Type | 5prime_partial |
Blastp | Membrane steroid-binding protein 1 from Oryza sativa with 56.92% of identity |
---|---|
Blastx | Membrane steroid-binding protein 1 from Oryza sativa with 56.92% of identity |
Eggnog | progesterone receptor membrane component(ENOG4111UG0) |
Kegg | Link to kegg annotations (4349046) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451091.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer