| Transcript | Ll_transcript_162668 |
|---|---|
| CDS coordinates | 184-519 (+) |
| Peptide sequence | MIMQASRIRFKFHKATADCTFMRIDGEPWKQPLPLDDDKVVVEISHHGQVSMLATPSCRSKSVHDPSSHTVDNEEEDSSDEESSENFEERRKFGAAHTFKYTDGSDIAHLS* |
| ORF Type | complete |
| Blastp | Diacylglycerol kinase 5 from Arabidopsis with 61.54% of identity |
|---|---|
| Blastx | Diacylglycerol kinase 5 from Arabidopsis with 59.26% of identity |
| Eggnog | DiacylGlycerol Kinase(ENOG410XQVB) |
| Kegg | Link to kegg annotations (AT2G20900) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020237924.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer