Protein coding transcript 162131

• Transcript: Ll_transcript_162654
• CDS coordinates: 168-1043 (+)
• Peptide sequence: MEPSSATGETNKVAVRSSILESFSGCGLSGIRIDKEELKKQLTMPQYLRFAMRDSIRHQDPGAGESRYIRRNDGEDAATPLCPMVVFINPRSGGRHGPVLKERLQQLMSDEQVFDLSDVKPHEFVRYGLGCLELLAGLGDTCAKETREKLRVVVAGGDGTVGWVLGCLTELRTLDREPVPPVGVIPLGTGNDLSRSFHWGGSFPFLWKSAIKRSLSKAITGPIHRLDSWRVSVLMPDGTHVDPPYSLKHTEEFTLDQGLEAEGELPEKVKSYEGVFYNYFSMGTFICTSIV*
• ORF Type: complete

Annotations of Ll_transcript_162654

• Blastp: Diacylglycerol kinase 7 from Arabidopsis with 62.41% of identity
• Blastx: Diacylglycerol kinase 7 from Arabidopsis with 62.41% of identity
• Eggnog: DiacylGlycerol Kinase(ENOG410XQVB)
• Kegg: Link to kegg annotations (AT4G30340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463640.1)
• Pfam: Diacylglycerol kinase catalytic domain (PF00781.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;