Protein coding transcript 162138

• Transcript: Ll_transcript_162670
• CDS coordinates: 200-1204 (+)
• Peptide sequence: MEPPSVTGKTKKIAVRSSIVESLRGCGLSGIRIDKEELKKQLTMPKYLRFAMRDSIRHQDSAAGESRYIHRNDGEDAAPPLSPMVVFINPRSGGRHGPVLKEWLQQLMSEEQVFDLSDVKPHEFVRYGLGCLEMLAGLGDSCAKETREKLRVMVAGGDGTVGWVLGCLIELRTLGREPVPPVGVIPLGTGNDLSRSFRWGGSFPYAWKSAIKRSLYRASTGPIHHLDSWRVSVLMPDGTHIDPPHSLKHTEEFTLDQGLEAEGELSERVKSYEGVFYNYFSIGMDAQVAYGFHHLRNEKPYLASGPISNKIIYSGYSCTQGWFFTPCTSDPGLR*
• ORF Type: complete

Annotations of Ll_transcript_162670

• Blastp: Diacylglycerol kinase 7 from Arabidopsis with 67.19% of identity
• Blastx: Diacylglycerol kinase 7 from Arabidopsis with 67.19% of identity
• Eggnog: DiacylGlycerol Kinase(ENOG410XQVB)
• Kegg: Link to kegg annotations (AT4G30340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442198.1)
• Pfam: Diacylglycerol kinase catalytic domain (PF00781.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;