Transcript | Ll_transcript_162670 |
---|---|
CDS coordinates | 200-1204 (+) |
Peptide sequence | MEPPSVTGKTKKIAVRSSIVESLRGCGLSGIRIDKEELKKQLTMPKYLRFAMRDSIRHQDSAAGESRYIHRNDGEDAAPPLSPMVVFINPRSGGRHGPVLKEWLQQLMSEEQVFDLSDVKPHEFVRYGLGCLEMLAGLGDSCAKETREKLRVMVAGGDGTVGWVLGCLIELRTLGREPVPPVGVIPLGTGNDLSRSFRWGGSFPYAWKSAIKRSLYRASTGPIHHLDSWRVSVLMPDGTHIDPPHSLKHTEEFTLDQGLEAEGELSERVKSYEGVFYNYFSIGMDAQVAYGFHHLRNEKPYLASGPISNKIIYSGYSCTQGWFFTPCTSDPGLR* |
ORF Type | complete |
Blastp | Diacylglycerol kinase 7 from Arabidopsis with 67.19% of identity |
---|---|
Blastx | Diacylglycerol kinase 7 from Arabidopsis with 67.19% of identity |
Eggnog | DiacylGlycerol Kinase(ENOG410XQVB) |
Kegg | Link to kegg annotations (AT4G30340) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442198.1) |
Pfam | Diacylglycerol kinase catalytic domain (PF00781.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer