Transcript | Ll_transcript_162642 |
---|---|
CDS coordinates | 168-944 (+) |
Peptide sequence | MEPSSATGETNKVAVRSSILESFSGCGLSGIRIDKEELKKQLTMPQYLRFAMRDSIRHQDPGAGESRYIRRNDGEDAATPLCPMVVFINPRSGGRHGPVLKERLQQLMSDEQVFDLSDVKPHEFVRYGLGCLELLAGLGDTCAKETREKLRVVVAGGDGTVGWVLGCLTELRTLDREPVPPVGVIPLGTGNDLSRSFHWGGSFPFLWKSAIKRSLSKAITGPIHRLDRYVLSFTVTFSSVVLQFSSSCLQINCFIKFI* |
ORF Type | complete |
Blastp | Diacylglycerol kinase 3 from Arabidopsis with 58.13% of identity |
---|---|
Blastx | Diacylglycerol kinase 3 from Arabidopsis with 62.16% of identity |
Eggnog | DiacylGlycerol Kinase(ENOG410XQVB) |
Kegg | Link to kegg annotations (AT2G18730) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463640.1) |
Pfam | Diacylglycerol kinase catalytic domain (PF00781.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer