Transcript | Ll_transcript_163587 |
---|---|
CDS coordinates | 54-374 (+) |
Peptide sequence | MATTTTNPTKTQPNSDEDAAAESKPAPAPASDSGNDSSLSDANKKIRRAERFGITLQLSEKEKRNSRAERFGITSSTIEGSETSKAEELKRKARAERFSLSNFSNF* |
ORF Type | complete |
Blastp | Protein MODIFIER OF SNC1 11 from Arabidopsis with 63.38% of identity |
---|---|
Blastx | Protein MODIFIER OF SNC1 11 from Arabidopsis with 59.09% of identity |
Eggnog | NA(ENOG410Y0Z2) |
Kegg | Link to kegg annotations (AT5G02770) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456431.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer