| Transcript | Ll_transcript_163618 |
|---|---|
| CDS coordinates | 54-374 (+) |
| Peptide sequence | MATTTTNPTKTQPNSDEDAAAESKPAPAPASDSGNDSSLSDANKKIRRAERFGITLQLSEKEKRNSRAERFGITSSTIEGSETSKAEELKRKARAERFSLSNFSNF* |
| ORF Type | complete |
| Blastp | Protein MODIFIER OF SNC1 11 from Arabidopsis with 63.38% of identity |
|---|---|
| Blastx | Protein MODIFIER OF SNC1 11 from Arabidopsis with 59.09% of identity |
| Eggnog | NA(ENOG410Y0Z2) |
| Kegg | Link to kegg annotations (AT5G02770) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019456431.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer