Protein coding transcript 162163

• Transcript: Ll_transcript_163596
• CDS coordinates: 54-578 (+)
• Peptide sequence: MATTTTNPTKTQPNSDEDAAAESKPAPAPASDSGNDSSLSDANKKIRRAERFGITLQLSEKEKRNSRAERFGITSSTIEGSETSKAEELKRKARAERFGVPVPTTTADEEAKKKARLARFSSASKAAVDPAEEDKRKARALRFSNPSSGSLTQVNGEGSIEPKAVIAGKAGGGD*
• ORF Type: complete

Annotations of Ll_transcript_163596

• Blastp: Protein MODIFIER OF SNC1 11 from Arabidopsis with 65.57% of identity
• Blastx: Protein MODIFIER OF SNC1 11 from Arabidopsis with 62.5% of identity
• Eggnog: NA(ENOG410Y0Z2)
• Kegg: Link to kegg annotations (AT5G02770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444372.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;