Protein coding transcript 162269

• Transcript: Ll_transcript_163198
• CDS coordinates: 745-1416 (+)
• Peptide sequence: MGSFLRYGRHGVRQIIRFRDAANDSSVVNPLLYASQGLRYNRKLQVILTSNIDKLGKAGDTVKVAPGYFRNHLMPKLLAVPNIDKFAYLITEQRKVYQPTEKEEKKDVKVVKESKEDMMKEYEKAALRLDKAKLVLRRLIDVQKAKARATKDDPLELRYPITKEVLVAEVSRQLCVNIAPENLHLPSPLSILGEYEVPLRLPRSIPLPEGKVNWSLKVKIRSK*
• ORF Type: complete

Annotations of Ll_transcript_163198

• Blastp: 50S ribosomal protein L9 from Pelobacter with 33.51% of identity
• Blastx: 50S ribosomal protein L9 from Pelobacter with 31.35% of identity
• Eggnog: Binds to the 23S rRNA (By similarity)(COG0359)
• Kegg: Link to kegg annotations (Ppro_0761)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438674.1)
• Pfam: Ribosomal protein L9, N-terminal domain (PF01281.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;