Transcript | Ll_transcript_163199 |
---|---|
CDS coordinates | 251-922 (+) |
Peptide sequence | MGSFLRYGRHGVRQIIRFRDAANDSSVVNPLLYASQGLRYNRKLQVILTSNIDKLGKAGDTVKVAPGYFRNHLMPKLLAVPNIDKFAYLITEQRKVYQPTEKEEKKDVKVVKESKEDMMKEYEKAALRLDKAKLVLRRLIDVQKAKARATKDDPLELRYPITKEVLVAEVSRQLCVNIAPENLHLPSPLSILGEYEVPLRLPRSIPLPEGKVNWSLKVKIRSK* |
ORF Type | complete |
Blastp | 50S ribosomal protein L9 from Pelobacter with 33.51% of identity |
---|---|
Blastx | 50S ribosomal protein L9 from Pelobacter with 31.35% of identity |
Eggnog | Binds to the 23S rRNA (By similarity)(COG0359) |
Kegg | Link to kegg annotations (Ppro_0761) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438674.1) |
Pfam | Ribosomal protein L9, N-terminal domain (PF01281.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer