Protein coding transcript 162303

• Transcript: Ll_transcript_163333
• CDS coordinates: 2568-2885 (+)
• Peptide sequence: MENMSPWERYNYWFVAGTILNILGLIYHVQVEAALQGSHFVDNIMVHADPFHSYCVALVVVSHQALEEWASKQGIAYSDFSELCRKDETAKEVSASLLKEAKKARL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_163333

• Blastp: Long chain acyl-CoA synthetase 9, chloroplastic from Arabidopsis with 62.34% of identity
• Blastx: Long chain acyl-CoA synthetase 9, chloroplastic from Arabidopsis with 84.62% of identity
• Eggnog: Amp-dependent synthetase and ligase(COG1022)
• Kegg: Link to kegg annotations (AT1G77590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438577.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;