Protein coding transcript 162352

• Transcript: Ll_transcript_163822
• CDS coordinates: 1028-1738 (+)
• Peptide sequence: MQMFTLKLIFLFNLGGIFLIILLTHVLAKERAARLEILGWICVVLSTSVFAAPLSIIVRYLLLRLRFLLYVKYNSLNNHHACMVDLVQFQKVVIRTKSVEFMPLPLSALLTISAIMWMAYGILLRDIYVTLPNIVGVTFGTIQMVLYAIYRKQKPVKDQKLPEHKGDINDENLASTVTNTNHGVIPQLVEIEIGEEKKEQKQVQDEPQKNQDQTECNNNINKTRELGGIQAQGLRS*
• ORF Type: complete

Annotations of Ll_transcript_163822

• Blastp: Bidirectional sugar transporter SWEET15 from Vitis with 36.52% of identity
• Blastx: Bidirectional sugar transporter SWEET14 from Oryza sativa with 41.22% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (100243643)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462681.1)
• Pfam: Sugar efflux transporter for intercellular exchange (PF03083.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;