Protein coding transcript 162371

• Transcript: Ll_transcript_163469
• CDS coordinates: 2049-2354 (+)
• Peptide sequence: MKHYIFELENHLAEAQKHAYRLVKRHRELGQSLSDFGKAVKLLGATEGNSLGKAFSELGMKSEALSVKLQNEAQQLLVNFEEPLKDYVRAVQSIKATIAERA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_163469

• Blastp: Sorting nexin 1 from Arabidopsis with 84.31% of identity
• Blastx: Sorting nexin 1 from Arabidopsis with 83.05% of identity
• Eggnog: sorting nexin(COG5391)
• Kegg: Link to kegg annotations (AT5G06140)
• CantataDB: Link to cantataDB annotations (CNT0002034)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428711.1)
• Pfam: Vps5 C terminal like (PF09325.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;