Protein coding transcript 162373

• Transcript: Ll_transcript_163455
• CDS coordinates: 572-1132 (+)
• Peptide sequence: MRRLALDIFVNRIASHHELQQSEDLRLFLQAEEETMERLRSHENGIFKKKPSDFMQIFKDVQSKVSDVVLGKEKPVEESDPEYEKMKHYIFELENHLAEAQKHAYRLVKRHRELGQSLSDFGKAVKLLGATEGNSLGKAFSELGMKSEALSVKLQNEAQQLLVNFEEPLKDYVRAVQSIKATIAERA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_163455

• Blastp: Sorting nexin 1 from Arabidopsis with 80.21% of identity
• Blastx: Sorting nexin 1 from Arabidopsis with 83.67% of identity
• Eggnog: sorting nexin(COG5391)
• Kegg: Link to kegg annotations (AT5G06140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428712.1)
• Pfam: Vps5 C terminal like (PF09325.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;