Protein coding transcript 162376

• Transcript: Ll_transcript_163461
• CDS coordinates: 996-1859 (+)
• Peptide sequence: MQHSFFNTTSHTMNPSQRSLSGSLQSPRSPSSSQPFLSVSVTDPVKLGNGVQAYISYRVITKTNFPEYQGPEKIVIRRYSDFIWLRDRLFEKYKGIFIPPLPEKSAVEKFRFSAEFIEMRRLALDIFVNRIASHHELQQSEDLRLFLQAEEETMERLRSHENGIFKKKPSDFMQIFKDVQSKVSDVVLGKEKPVEESDPEYEKMKHYIFELENHLAEAQKHAYRLVKRHRELGQSLSDFGKAVKLLGATEGNSLGKAFSELGMKSEALSVKLQNEVSFACSMVYTWY*
• ORF Type: complete

Annotations of Ll_transcript_163461

• Blastp: Sorting nexin 1 from Arabidopsis with 83.78% of identity
• Blastx: Sorting nexin 1 from Arabidopsis with 84.75% of identity
• Eggnog: sorting nexin(COG5391)
• Kegg: Link to kegg annotations (AT5G06140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428711.1)
• Pfam: PX domain (PF00787.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;