Transcript | Ll_transcript_163462 |
---|---|
CDS coordinates | 559-1068 (+) |
Peptide sequence | MRRLALDIFVNRIASHHELQQSEDLRLFLQAEEETMERLRSHENGIFKKKPSDFMQIFKDVQSKVSDVVLGKEKPVEESDPEYEKMKHYIFELENHLAEAQKHAYRLVKRHRELGQSLSDFGKAVKLLGATEGNSLGKAFSELGMKSEALSVKLQNEVSFACSMVYTWY* |
ORF Type | complete |
Blastp | Sorting nexin 1 from Arabidopsis with 78.48% of identity |
---|---|
Blastx | Sorting nexin 1 from Arabidopsis with 82.87% of identity |
Eggnog | sorting nexin(COG5391) |
Kegg | Link to kegg annotations (AT5G06140) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428711.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer