| Transcript | Ll_transcript_163462 |
|---|---|
| CDS coordinates | 559-1068 (+) |
| Peptide sequence | MRRLALDIFVNRIASHHELQQSEDLRLFLQAEEETMERLRSHENGIFKKKPSDFMQIFKDVQSKVSDVVLGKEKPVEESDPEYEKMKHYIFELENHLAEAQKHAYRLVKRHRELGQSLSDFGKAVKLLGATEGNSLGKAFSELGMKSEALSVKLQNEVSFACSMVYTWY* |
| ORF Type | complete |
| Blastp | Sorting nexin 1 from Arabidopsis with 78.48% of identity |
|---|---|
| Blastx | Sorting nexin 1 from Arabidopsis with 82.87% of identity |
| Eggnog | sorting nexin(COG5391) |
| Kegg | Link to kegg annotations (AT5G06140) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019428711.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer