Protein coding transcript 162424

• Transcript: Ll_transcript_163413
• CDS coordinates: 945-1850 (+)
• Peptide sequence: MMMFGLVQVIMSFIPDLHNMAWVSVVAATMSLTYSFIGLGLGLATVIENGRIMGSVTGVPAANIADKLWLVFQALGDIAFAYPYSVILLEIQDTLKSPPPENKTMKKASMIAIFVTTFFYLCCGCFGYAAFGNQTPGNLLTGFGFYEPYWLIDFANACIVLHLVGGYQIFSQPIYSAADRWCSRKYPNTGFVNNHYKLKLPLLPAFPLNPFRICFRTAYVISTTGLAILFPYFNQVLGVLGAISFWPLAIYFPVEMYFVQKKIGAWSTKWVVLRIFSFVCFLVSVMGLVGSIEGIISQKLS*
• ORF Type: complete

Annotations of Ll_transcript_163413

• Blastp: Probable amino acid permease 7 from Arabidopsis with 64.12% of identity
• Blastx: Probable amino acid permease 7 from Arabidopsis with 60.56% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (AT5G23810)
• CantataDB: Link to cantataDB annotations (CNT0002804)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435717.1)
• Pfam: Transmembrane amino acid transporter protein (PF01490.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;